Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMA/Granzyme A, Human (HEK293, His)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Human (HEK293, His) is the recombinant human-derived GZMA/Granzyme A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GZMA/Granzyme A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gzma-granzyme-a-protein-human-hek293-his.html

Purity

97.00

Smiles

EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Molecular Formula

3001 (Gene_ID) P12544-1/NP_006135.1 (E27-V262) (Accession)

Molecular Weight

Approximately 27-33 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Methoxybenzyl formate
TN9576-01 50 mg

4-Methoxybenzyl formate

Sign In for Pricing
View Details
4-Methoxybenzyl formate
TN9576-02 100 mg

4-Methoxybenzyl formate

Sign In for Pricing
View Details
DOLK Over-expression Lysate Product
GWB-775D61 0.1 mg

DOLK Over-expression Lysate Product

Sign In for Pricing
View Details
SPHK1 Peptide
350489 0.1 mg

SPHK1 Peptide

Sign In for Pricing
View Details
Human AA3R full length protein-synthetic nanodisc
E33F100174 10 µg

Human AA3R full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Rabbit Polyclonal PRAM1 Antibody [CoraFluor 1]
NBP2-98045CL1 0.1 mL

Rabbit Polyclonal PRAM1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details