Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA1/LIR-6/CD85i, Human (HEK293, His)

LILRA1/LIR-6/CD85i protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and possibly influencing immune activity. LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is the recombinant human-derived LILRA1/LIR-6/CD85i protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRA1/LIR-6/CD85i Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilra1-lir-6-cd85i-protein-human-hek293-his.html

Purity

97.50

Smiles

PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN

Molecular Formula

11024 (Gene_ID) O75019-1 (P17-N461) (Accession)

Molecular Weight

Approximately 70-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD4 Rabbit Polyclonal Antibody (Carrier-free)
orb3115995 100 µg

NEDD4 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
MARK3 (NM_001128919) Human Tagged ORF Clone Lentiviral Particle
RC226129L3V 200 µL

MARK3 (NM_001128919) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tert-Butyl (S-4-Methyl-1- ((R) -2-methyloxiran-2-yl) -1-oxopentan-2-yl) carbamate
467039-01 1 mg

Tert-Butyl (S-4-Methyl-1- ((R) -2-methyloxiran-2-yl) -1-oxopentan-2-yl) carbamate

Sign In for Pricing
View Details
Tert-Butyl (S-4-Methyl-1- ((R) -2-methyloxiran-2-yl) -1-oxopentan-2-yl) carbamate
467039-02 10 mg

Tert-Butyl (S-4-Methyl-1- ((R) -2-methyloxiran-2-yl) -1-oxopentan-2-yl) carbamate

Sign In for Pricing
View Details
HIP1 CRISPR Activation Plasmid (h2)
sc-402515-ACT-2 20 µg

HIP1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Cdc25b Antibody / M-phase inducer phosphatase 2
RQ7068 100 µg

Cdc25b Antibody / M-phase inducer phosphatase 2

Sign In for Pricing
View Details