JMJD1C, Human (His-SUMO-Myc)
The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag.
Product Specifications
Product Name Alternative
JMJD1C Protein, Human (His-SUMO-Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/jmjd1c-protein-human-his-sumo.html
Purity
90.0
Smiles
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Molecular Formula
221037 (Gene_ID) Q15652-1 (M2274-R2498) (Accession)
Molecular Weight
Approximately 45.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
036159-ML405 100 µL
GOLGA5, ID (GOLGA5, RETII, RFG5, Golgin subfamily A member 5, Cell proliferation-inducing gene 31 protein, Golgin-84, Protein Ret-II, RET-fused gene 5 protein) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
MBS7059944 Inquire
Recombinant Marchantia polymorpha ATP synthase protein MI25 (YMF39), partial
Sign In for Pricing
View Details 
NBP3-26950MFV500 0.1 mL
Mouse Monoclonal Haptoglobin Antibody (HP/3834) [mFluor Violet 500 SE]
Sign In for Pricing
View Details