Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD1C, Human (His-SUMO-Myc)

The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag.

Product Specifications

Product Name Alternative

JMJD1C Protein, Human (His-SUMO-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jmjd1c-protein-human-his-sumo.html

Purity

90.0

Smiles

MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR

Molecular Formula

221037 (Gene_ID) Q15652-1 (M2274-R2498) (Accession)

Molecular Weight

Approximately 45.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF16 (NM_001045480) Human Over-expression Lysate
LC420754 20 µg

PRAMEF16 (NM_001045480) Human Over-expression Lysate

Sign In for Pricing
View Details
MKT 077 25mg
A12388-25 25 mg

MKT 077 25mg

Sign In for Pricing
View Details
Prelid1 Mouse shRNA Lentiviral Particle (Locus ID 66494)
TL516120V 500 µL Each

Prelid1 Mouse shRNA Lentiviral Particle (Locus ID 66494)

Sign In for Pricing
View Details
Complement Factor B, Ba Fragment (FITC)
MBS6249781-01 0.1 mL

Complement Factor B, Ba Fragment (FITC)

Sign In for Pricing
View Details
Complement Factor B, Ba Fragment (FITC)
MBS6249781-02 5x 0.1 mL

Complement Factor B, Ba Fragment (FITC)

Sign In for Pricing
View Details
PPAP2B (N-Term) Rabbit pAb
MBS8557140-01 0.1 mL

PPAP2B (N-Term) Rabbit pAb

Sign In for Pricing
View Details