JMJD1C, Human (His-SUMO-Myc)
The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag.
Product Specifications
Product Name Alternative
JMJD1C Protein, Human (His-SUMO-Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/jmjd1c-protein-human-his-sumo.html
Purity
90.0
Smiles
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Molecular Formula
221037 (Gene_ID) Q15652-1 (M2274-R2498) (Accession)
Molecular Weight
Approximately 45.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041037-500 1x 500 µL
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
