JMJD1C, Human (His-SUMO-Myc)
The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag.
Product Specifications
Product Name Alternative
JMJD1C Protein, Human (His-SUMO-Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/jmjd1c-protein-human-his-sumo.html
Purity
90.0
Smiles
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Molecular Formula
221037 (Gene_ID) Q15652-1 (M2274-R2498) (Accession)
Molecular Weight
Approximately 45.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL514800V 500 µL Each
Trim71 Mouse shRNA Lentiviral Particle (Locus ID 636931)
Sign In for Pricing
View Details 
MBS7201471-01 48 Well
Sheep Beta-hexosaminidase subunit beta (HEXB) ELISA Kit
Sign In for Pricing
View Details MBS7201471-02 96 Well
Sheep Beta-hexosaminidase subunit beta (HEXB) ELISA Kit
Sign In for Pricing
View Details MBS7201471-03 5x 96 Well
Sheep Beta-hexosaminidase subunit beta (HEXB) ELISA Kit
Sign In for Pricing
View Details