Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD1C, Human (His-SUMO-Myc)

The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag.

Product Specifications

Product Name Alternative

JMJD1C Protein, Human (His-SUMO-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jmjd1c-protein-human-his-sumo.html

Purity

90.0

Smiles

MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR

Molecular Formula

221037 (Gene_ID) Q15652-1 (M2274-R2498) (Accession)

Molecular Weight

Approximately 45.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRPF3 (Bromodomain and PHD Finger-Containing Protein 3, Bromodomain and PHD Finger Containing 3)
476386 100 µL

BRPF3 (Bromodomain and PHD Finger-Containing Protein 3, Bromodomain and PHD Finger Containing 3)

Sign In for Pricing
View Details
Human hsa-miR-135b-3p miRNA Antagomir
abx885833-01 10 nmol

Human hsa-miR-135b-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-135b-3p miRNA Antagomir
abx885833-02 20 nmol

Human hsa-miR-135b-3p miRNA Antagomir

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 1 ELISA Kit
MBS3804011-01 48 Well

Human Matrix Metalloproteinase 1 ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 1 ELISA Kit
MBS3804011-02 96 Well

Human Matrix Metalloproteinase 1 ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 1 ELISA Kit
MBS3804011-03 5x 96 Well

Human Matrix Metalloproteinase 1 ELISA Kit

Sign In for Pricing
View Details