Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD1C, Human (His-SUMO-Myc)

The JMJD1C protein is a possible histone demethylase that centrally affects the histone code by targeting “Lys-9” of histone H3. Its enzymatic activity produces formaldehyde and succinic acid. JMJD1C Protein, Human (His-SUMO-Myc) is the recombinant human-derived JMJD1C protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag.

Product Specifications

Product Name Alternative

JMJD1C Protein, Human (His-SUMO-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jmjd1c-protein-human-his-sumo.html

Purity

90.0

Smiles

MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR

Molecular Formula

221037 (Gene_ID) Q15652-1 (M2274-R2498) (Accession)

Molecular Weight

Approximately 45.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FAM188B Antibody [DyLight 680]
NBP3-05876FR 0.1 mL

Rabbit Polyclonal FAM188B Antibody [DyLight 680]

Sign In for Pricing
View Details
C12orf29 Protein Vector (Human) (pPB-His-MBP)
PV328542 500 ng

C12orf29 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Recombinant Human EGFR Protein (His Tag)
MBS2569262-01 0.02 mg

Recombinant Human EGFR Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human EGFR Protein (His Tag)
MBS2569262-02 0.1 mg

Recombinant Human EGFR Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human EGFR Protein (His Tag)
MBS2569262-03 5x 0.1 mg

Recombinant Human EGFR Protein (His Tag)

Sign In for Pricing
View Details
Rat Uroplakin 3A (UPK3A) ELISA Kit
EKN49488 96 Tests

Rat Uroplakin 3A (UPK3A) ELISA Kit

Sign In for Pricing
View Details