Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial (Active)

Product Specifications

Product Name Alternative

MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1

Abbreviation

Recombinant Human MICA protein, partial (Active)

Gene Name

MICA

UniProt

AAH16929.1

Expression Region

24-308aa

Organism

Homo sapiens (Human)

Target Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Tag

C-terminal Fc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

MHC class I polypeptide-related sequence A, also known as MIC-A, PERB11.1 and MICA, is a single-pass type I membrane protein which belongs to the MHC class I family of MIC subfamily. MICA contains one Ig-like C1-type domain and is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by NK cells, NKT cells, and most of the subtypes of T cells. MICA is the ligand for NK cell activating receptor KLRK1/NKG2D. MICA seems to have no role in antigen presentation. MICA leads to cell lysis by binding to KLRK1.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.

Molecular Weight

59.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M/M021/NL387/RLFBD-400X600-1 Electrical & Equipment Safety Signs (No Adhesive)
305671 1 Pack (1 Panel (s) x 1 Pack)

M/M021/NL387/RLFBD-400X600-1 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
Anti-Mouse CD20/MS4A1 Antibody (18B12), APC
MBS1585788-01 50 Tests

Anti-Mouse CD20/MS4A1 Antibody (18B12), APC

Sign In for Pricing
View Details
Anti-Mouse CD20/MS4A1 Antibody (18B12), APC
MBS1585788-02 100 Tests

Anti-Mouse CD20/MS4A1 Antibody (18B12), APC

Sign In for Pricing
View Details
Anti-Mouse CD20/MS4A1 Antibody (18B12), APC
MBS1585788-03 5x 100 Tests

Anti-Mouse CD20/MS4A1 Antibody (18B12), APC

Sign In for Pricing
View Details
LCP2 Protein Vector (Mouse) (pPM-C-HA)
PV196148 500 ng

LCP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FANCI (Fanconi-associated Nuclease 1, KIAA1794) (Biotin)
MBS6416906-01 0.1 mL

FANCI (Fanconi-associated Nuclease 1, KIAA1794) (Biotin)

Sign In for Pricing
View Details