Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4) (U73S), partial

Product Specifications

Product Name Alternative

PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4

Abbreviation

Recombinant Human GPX4 protein (U73S), partiall

Gene Name

GPX4

UniProt

P36969

Expression Region

29-197aa (U73S)

Organism

Homo sapiens (Human)

Target Sequence

CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Essential antioxidant peroxidase that directly reduces phospholipid hydroperoxide even if they are incorporated in membranes and lipoproteins (By similarity) . Can also reduce fatty acid hydroperoxide, cholesterol hydroperoxide and thymine hydroperoxide (By similarity) . Plays a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation (By similarity) . Required to prevent cells from ferroptosis, a non-apoptotic cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species (PubMed:24439385) . The presence of selenocysteine (Sec) versus Cys at the active site is essential for life: it provides resistance to overoxidation and prevents cells against ferroptosis (By similarity) . The presence of Sec at the active site is also essential for the survival of a specific type of parvalbumin-positive interneurons, thereby preventing against fatal epileptic seizures (By similarity) . May be required to protect cells from the toxicity of ingested lipid hydroperoxides (By similarity) . Required for normal sperm development and male fertility (By similarity) . Essential for maturation and survival of photoreceptor cells (By similarity) . Plays a role in a primary T-cell response to viral and parasitic infection by protecting T-cells from ferroptosis and by supporting T-cell expansion (By similarity) . Plays a role of glutathione peroxidase in platelets in the arachidonic acid metabolism (PubMed:11115402) . Reduces hydroperoxy ester lipids formed by a 15-lipoxygenase that may play a role as down-regulator of the cellular 15-lipoxygenase pathway (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

References & Citations

"Regulation of ferroptotic cancer cell death by GPX4." Yang W.S., SriRamaratnam R., Welsch M.E., Shimada K., Skouta R., Viswanathan V.S., Cheah J.H., Clemons P.A., Shamji A.F., Clish C.B., Brown L.M., Girotti A.W., Cornish V.W., Schreiber S.L., Stockwell B.R. Cell 156:317-331 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Acetyl-p53 (K382) Antibody, mAb, Rabbit
A02921-100 100 µL

Acetyl-p53 (K382) Antibody, mAb, Rabbit

Ask
View Details
AKT1S1/PRAS40 Rabbit pAb
A21686-01 20 µL

AKT1S1/PRAS40 Rabbit pAb

Ask
View Details
AKT1S1/PRAS40 Rabbit pAb
A21686-02 100 μL

AKT1S1/PRAS40 Rabbit pAb

Ask
View Details
AKT1S1/PRAS40 Rabbit pAb
A21686-03 500 μL

AKT1S1/PRAS40 Rabbit pAb

Ask
View Details
AKT1S1/PRAS40 Rabbit pAb
A21686-04 1000 μL

AKT1S1/PRAS40 Rabbit pAb

Ask
View Details
Rabbit Polyclonal HSP90 beta Antibody [DyLight 550]
NBP1-77561R 0.1 mL

Rabbit Polyclonal HSP90 beta Antibody [DyLight 550]

Ask
View Details