Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPG21, Human (sf9, His)

The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Product Specifications

Product Name Alternative

SPG21 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spg21-protein-human-sf9-gst.html

Purity

96.00

Smiles

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ

Molecular Formula

51324 (Gene_ID) Q9NZD8-1 (M1-Q308) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC27 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
48677124 3x 1.0µg DNA

TTC27 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Staufen polyclonal antibody
orb646880-01 50 μL

Staufen polyclonal antibody

Sign In for Pricing
View Details
Staufen polyclonal antibody
orb646880-02 100 µL

Staufen polyclonal antibody

Sign In for Pricing
View Details
Staufen polyclonal antibody
orb646880-03 200 µL

Staufen polyclonal antibody

Sign In for Pricing
View Details
Recombinant Cowpox virus CPXV199 protein (CPXV199), partial
RPC31663-01 20 µg

Recombinant Cowpox virus CPXV199 protein (CPXV199), partial

Sign In for Pricing
View Details
Recombinant Cowpox virus CPXV199 protein (CPXV199), partial
RPC31663-02 100 µg

Recombinant Cowpox virus CPXV199 protein (CPXV199), partial

Sign In for Pricing
View Details