Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC30A8, Mouse (Cell-Free, His)

SLC30A8 Protein, a proton-coupled zinc ion antiporter, crucially regulates insulin secretion. Serving as a mediator, SLC30A8 enables zinc entry into pancreatic beta cell secretory granules, maintaining the required zinc concentration. This process finely tunes insulin release dynamics, emphasizing SLC30A8's pivotal role in physiological insulin secretion control and glucose homeostasis. SLC30A8 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived SLC30A8 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC30A8 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc30a8-protein-mouse-cf-his.html

Purity

91.00

Smiles

MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD

Molecular Formula

239436 (Gene_ID) Q8BGG0 (M1-D367) (Accession)

Molecular Weight

Monomer: 43 kDa Dimer: 86 kDa It is speculated that the protein forms a dimeric structure.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dlc1 activation kit by CRISPRa
GA205350 1 Kit

Mouse Dlc1 activation kit by CRISPRa

Sign In for Pricing
View Details
PLCXD1 Human shRNA Plasmid Kit (Locus ID 55344)
TL302444 1 Kit

PLCXD1 Human shRNA Plasmid Kit (Locus ID 55344)

Sign In for Pricing
View Details
STX7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
45805124 3x 1.0µg DNA

STX7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Hamster Translocating Chain-Associated Membrane Protein 2 (TRAM2) ELISA Kit
MBS9905512-01 48 Well

Hamster Translocating Chain-Associated Membrane Protein 2 (TRAM2) ELISA Kit

Sign In for Pricing
View Details
Hamster Translocating Chain-Associated Membrane Protein 2 (TRAM2) ELISA Kit
MBS9905512-02 96 Well

Hamster Translocating Chain-Associated Membrane Protein 2 (TRAM2) ELISA Kit

Sign In for Pricing
View Details
Hamster Translocating Chain-Associated Membrane Protein 2 (TRAM2) ELISA Kit
MBS9905512-03 5x 96 Well

Hamster Translocating Chain-Associated Membrane Protein 2 (TRAM2) ELISA Kit

Sign In for Pricing
View Details