Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC30A8, Mouse (Cell-Free, His)

SLC30A8 Protein, a proton-coupled zinc ion antiporter, crucially regulates insulin secretion. Serving as a mediator, SLC30A8 enables zinc entry into pancreatic beta cell secretory granules, maintaining the required zinc concentration. This process finely tunes insulin release dynamics, emphasizing SLC30A8's pivotal role in physiological insulin secretion control and glucose homeostasis. SLC30A8 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived SLC30A8 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC30A8 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc30a8-protein-mouse-cf-his.html

Purity

91.00

Smiles

MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD

Molecular Formula

239436 (Gene_ID) Q8BGG0 (M1-D367) (Accession)

Molecular Weight

Monomer: 43 kDa Dimer: 86 kDa It is speculated that the protein forms a dimeric structure.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESCO1 Protein Vector (Human) (pPM-C-His)
PV076176 500 ng

ESCO1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
D-Glutamic acid
GE7245-5g 5 g

D-Glutamic acid

Sign In for Pricing
View Details
Active Interleukin 1 Beta (IL1b)
SBPA147Mu01-01 10 µg

Active Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Active Interleukin 1 Beta (IL1b)
SBPA147Mu01-02 50 µg

Active Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Active Interleukin 1 Beta (IL1b)
SBPA147Mu01-03 200 µg

Active Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Active Interleukin 1 Beta (IL1b)
SBPA147Mu01-04 1 mg

Active Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details