Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1/ERK2, Human (sf9, His)

ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

MAPK1/ERK2 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erk2-protein-human-sf9-gst.html

Purity

95.00

Smiles

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Molecular Formula

5594 (Gene_ID) P28482-1 (M1-S360) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®405M Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2mg/mL
#20214-1 1x 50 µL

CF®405M Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2mg/mL

Sign In for Pricing
View Details
SMARCA1 Rabbit Polyclonal Antibody
TA367549 100 µL

SMARCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLUR3 (GRIA3) Mouse Monoclonal Antibody [Clone ID: 1D2]
AM06645SU-N 100 µL

GLUR3 (GRIA3) Mouse Monoclonal Antibody [Clone ID: 1D2]

Sign In for Pricing
View Details
CLN6 (NM_017882) Human Over-expression Lysate
LC402624 20 µg

CLN6 (NM_017882) Human Over-expression Lysate

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF640R conjugate, 0.1mg/mL
BNC402564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRYGA Human Gene Knockout Kit (CRISPR)
KN424787 1 Kit

CRYGA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details