Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1/ERK2, Human (sf9, His)

ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

MAPK1/ERK2 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erk2-protein-human-sf9-gst.html

Purity

95.00

Smiles

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Molecular Formula

5594 (Gene_ID) P28482-1 (M1-S360) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ximelagatran
TRC-X745000-2.5MG 2.5 mg

Ximelagatran

Sign In for Pricing
View Details
DMT1 Recombinant Rabbit monoclonal Antibody
HA751274 100 µL

DMT1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells,  10nm
GM-01-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells, 10nm

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF488A conjugate, 0.1mg/mL
BNC881167-500 1x 500 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cnpy1 Mouse Gene Knockout Kit (CRISPR)
KN503569 1 Kit

Cnpy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF594 conjugate, 0.1mg/mL
BNC940637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details