Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 2, Mouse (HEK293, His)

Carbonic Anhydrase 2 Protein is a member of the carbonic anhydrase isozyme family, responsible for catalyzing the reversible hydration of carbon dioxide. Mutations in CA2 are linked to osteopetrosis and renal tubular acidosis. The gene exhibits biased expression in various tissues, notably in the stomach and colon. CA2 plays vital role in the regulation of ion transport and pH balance and is involved in many biological processes. Carbonic Anhydrase 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-2-protein-mouse-his.html

Purity

95.00

Smiles

SHHWGYSKHNGPENWHKDFPIANGDRQSPVDIDTATAQHDPALQPLLISYDKAASKSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQGLQKVLEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEGDAEEAMVDNWRPAQPLKNRKIKASFK

Molecular Formula

12349 (Gene_ID) AAH55291 (S2-K260) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pnpla2 (BC019188) Mouse Tagged Lenti ORF Clone
MR206855L3 10 µg

Pnpla2 (BC019188) Mouse Tagged Lenti ORF Clone

Ask
View Details
ACTL8 (NM_030812) Human Tagged ORF Clone Lentiviral Particle
RC205140L2V 200 µL

ACTL8 (NM_030812) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Lentiviral mouse Wdr70 shRNA (UAS) - Lentiviral mouse Wdr70 shRNA (UAS) (100)
GTR15241530 1 Vial

Lentiviral mouse Wdr70 shRNA (UAS) - Lentiviral mouse Wdr70 shRNA (UAS) (100)

Ask
View Details
Cre recombinase Recombinant Rabbit mAb
E43S49223 100 µL

Cre recombinase Recombinant Rabbit mAb

Ask
View Details
Alpha-Melanocyte Stimulating Hormone (αMSH) Porcine ELISA Kit
B4527 96 Tests

Alpha-Melanocyte Stimulating Hormone (αMSH) Porcine ELISA Kit

Ask
View Details