Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-selectin/CD62L, Cynomolgus (HEK293, His)

L-selectin/CD62L is a calcium-dependent lectin that aids cell adhesion by binding to neighboring glycoproteins. It mediates lymphocyte adhesion to endothelial cells in peripheral lymph nodes, causing leukocytes to tether and roll. L-selectin/CD62L Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

L-selectin/CD62L Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-cynomolgus-hek293-his.html

Purity

95.80

Smiles

DFLAHHGTDCWTYHYSENPMNWQKARRFCRENYTDLVAIQNKAEIEYLEKTLPFSPSYYWIGIRKIGGIWTWVGTNKSLTQEAENWGDGEPNNKKNKEDCVEIYIKRKKDAGKWNDDACHKPKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEPPKLGTMDCTHPLGDFSFSSQCAFNCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFSSACTFSCSEGTELIGEKKTICESSGIWSNPNPICQKLDRSFSMIKEGDYN

Molecular Formula

701419 (Gene_ID) Q95198 (D29-N332) (Accession)

Molecular Weight

Approximately 50-65 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF594 conjugate, 0.1mg/mL
BNC941788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), 0.2mg/mL
BNUB0253-500 1x 500 µL

Cytokeratin, LMW (AE-1), 0.2mg/mL

Sign In for Pricing
View Details
Cdc20 (CDC20/1102), CF740 conjugate, 0.1mg/mL
BNC741102-500 1x 500 µL

Cdc20 (CDC20/1102), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details