Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-selectin/CD62L, Cynomolgus (HEK293, His)

L-selectin/CD62L is a calcium-dependent lectin that aids cell adhesion by binding to neighboring glycoproteins. It mediates lymphocyte adhesion to endothelial cells in peripheral lymph nodes, causing leukocytes to tether and roll. L-selectin/CD62L Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

L-selectin/CD62L Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-cynomolgus-hek293-his.html

Purity

95.80

Smiles

DFLAHHGTDCWTYHYSENPMNWQKARRFCRENYTDLVAIQNKAEIEYLEKTLPFSPSYYWIGIRKIGGIWTWVGTNKSLTQEAENWGDGEPNNKKNKEDCVEIYIKRKKDAGKWNDDACHKPKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEPPKLGTMDCTHPLGDFSFSSQCAFNCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFSSACTFSCSEGTELIGEKKTICESSGIWSNPNPICQKLDRSFSMIKEGDYN

Molecular Formula

701419 (Gene_ID) Q95198 (D29-N332) (Accession)

Molecular Weight

Approximately 50-65 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARS2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
36042126 3x 1.0µg DNA

PARS2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Amyloid beta (free N-term, low APP reactive) Mouse Monoclonal Antibody [Clone ID: 19H11]
AM00007BT-N 100 µg

Amyloid beta (free N-term, low APP reactive) Mouse Monoclonal Antibody [Clone ID: 19H11]

Sign In for Pricing
View Details
Z-Ala-Met-OH
260719-01 1 g

Z-Ala-Met-OH

Sign In for Pricing
View Details
Z-Ala-Met-OH
260719-02 2 g

Z-Ala-Met-OH

Sign In for Pricing
View Details
Pack of 100 Sheets of Technical Creped Filter 140G/M², 600X600 Mm
FT111F4040C Pack of 100

Pack of 100 Sheets of Technical Creped Filter 140G/M², 600X600 Mm

Sign In for Pricing
View Details
Ovine sex hormone-binding globulin (SHBG) ELISA Kit
CK-bio-25412-01 48 Tests

Ovine sex hormone-binding globulin (SHBG) ELISA Kit

Sign In for Pricing
View Details