Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/arginine-rich splicing factor 3 (SRSF3), partial

Product Specifications

Product Name Alternative

Pre-mRNA-splicing factor SRP20; Splicing factor, arginine/serine-rich 3

Abbreviation

Recombinant Human SRSF3 protein, partial

Gene Name

SRSF3

UniProt

P84103

Expression Region

1-86aa

Organism

Homo sapiens (Human)

Target Sequence

MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR

Tag

N-terminal 6xHis-GB1-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl11 (BC021402) Mouse Tagged ORF Clone
MG201377 10 µg

Rpl11 (BC021402) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PRDM9 Rabbit Polyclonal Antibody
TA380303 100 µL

PRDM9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASGPR1 Recombinant Rabbit Monoclonal Antibody [PSH06-01]
HA722500 100 µL

ASGPR1 Recombinant Rabbit Monoclonal Antibody [PSH06-01]

Sign In for Pricing
View Details
Traf3ip2 Mouse Gene Knockout Kit (CRISPR)
KN518125 1 Kit

Traf3ip2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD3G (N-term) Rabbit Polyclonal Antibody
AP11514PU-N 400 µL

CD3G (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DKK1 (NM_012242) Human Recombinant Protein
TP710289 20 µg

DKK1 (NM_012242) Human Recombinant Protein

Sign In for Pricing
View Details