Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coronin-1A (CORO1A)

Product Specifications

Product Name Alternative

Coronin-like protein A; Clipin-A; Coronin-like protein p57; Tryptophan aspartate-containing coat protein; TACO

Abbreviation

Recombinant Human CORO1A protein

Gene Name

CORO1A

UniProt

P31146

Expression Region

2-461aa

Organism

Homo sapiens (Human)

Target Sequence

SRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

57.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-13C2 Chloride
TRC-A164498-25MG 25 mg

Acetyl-13C2 Chloride

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
RD-PDGFC-Mu-01 96 Tests

Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
RD-PDGFC-Mu-02 48 Tests

Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
3,5,8-Trichloroacenaphthene
TRC-T773940-2.5MG 2.5 mg

3,5,8-Trichloroacenaphthene

Sign In for Pricing
View Details
TSSK2 (NM_053006) Human Recombinant Protein
TP307232L 1 mg

TSSK2 (NM_053006) Human Recombinant Protein

Sign In for Pricing
View Details
Human Thromboxane Receptor (TP) ELISA Kit
RD-TBXA2R-Hu-01 96 Tests

Human Thromboxane Receptor (TP) ELISA Kit

Sign In for Pricing
View Details