Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rabbit

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rabbit is a recombinant rabbit IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G24-A153) .

Product Specifications

Product Name Alternative

IL-17A Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rabbit-tag-free.html

Purity

96.00

Smiles

GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Molecular Formula

100339322 (Gene_ID) G1SLF2 (G24-A153) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human PPBP/CXCL7 protein
ATGP1109-100 100 µg

Recombinant human PPBP/CXCL7 protein

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-01 20 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-02 60 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-03 120 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-04 200 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details
MLH1 Mouse Monoclonal Antibody [Clone ID: UMAB191]
UM870083 30 µL

MLH1 Mouse Monoclonal Antibody [Clone ID: UMAB191]

Sign In for Pricing
View Details