Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rabbit

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rabbit is a recombinant rabbit IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G24-A153) .

Product Specifications

Product Name Alternative

IL-17A Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rabbit-tag-free.html

Purity

96.00

Smiles

GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Molecular Formula

100339322 (Gene_ID) G1SLF2 (G24-A153) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Handimark Tapes - B-595 50mm red AF Systems Consumables
142280 Box of 1 Roll

Handimark Tapes - B-595 50mm red AF Systems Consumables

Sign In for Pricing
View Details
ZAR1 Adenovirus (Human)
50673051 1.0 mL

ZAR1 Adenovirus (Human)

Sign In for Pricing
View Details
Rabbit Anti-Nfasc186 antibody
SL11214R-01 50 µL

Rabbit Anti-Nfasc186 antibody

Sign In for Pricing
View Details
Rabbit Anti-Nfasc186 antibody
SL11214R-02 100 µL

Rabbit Anti-Nfasc186 antibody

Sign In for Pricing
View Details
Lentiviral human SLC25A40 shRNA (UAS) - Lentiviral human SLC25A40 shRNA (UAS) (100)
GTR15135150 1 Vial

Lentiviral human SLC25A40 shRNA (UAS) - Lentiviral human SLC25A40 shRNA (UAS) (100)

Sign In for Pricing
View Details
JAK2 siRNA (Mouse)
MBS8228428-01 15 nmol

JAK2 siRNA (Mouse)

Sign In for Pricing
View Details