Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rabbit

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rabbit is a recombinant rabbit IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G24-A153) .

Product Specifications

Product Name Alternative

IL-17A Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rabbit-tag-free.html

Purity

96.00

Smiles

GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Molecular Formula

100339322 (Gene_ID) G1SLF2 (G24-A153) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINT2 Rabbit Polyclonal Antibody
TA381947 100 µL

SPINT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Glucocorticoid Receptor (Ser226) Polyclonal Antibody
TMAB-10742-01 50 μL

Anti-Phospho-Glucocorticoid Receptor (Ser226) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Glucocorticoid Receptor (Ser226) Polyclonal Antibody
TMAB-10742-02 100 µL

Anti-Phospho-Glucocorticoid Receptor (Ser226) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Glucocorticoid Receptor (Ser226) Polyclonal Antibody
TMAB-10742-03 200 µL

Anti-Phospho-Glucocorticoid Receptor (Ser226) Polyclonal Antibody

Sign In for Pricing
View Details
Tau (MAPT) Human Over-expression Lysate
orb1369366 20 µg

Tau (MAPT) Human Over-expression Lysate

Sign In for Pricing
View Details
1-bromo-3-chloro-2-isopropoxybenzene
OR1099124-01 250 mg

1-bromo-3-chloro-2-isopropoxybenzene

Sign In for Pricing
View Details