Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) , partial (H294F, H296F, Y297C, H305F)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lrpap1

UniProt

P55302

Expression Region

248-360aa(H294F,H296F,Y297C,H305F)

Organism

Mus musculus

Target Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Tag

N-terminal GFP-tagged and C-terminal 6xHis-tagged

Source

Mammalian cell

Field of Research

Cardiovascular

Assay Type

Developed Protein

Relevance

Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

References & Citations

"Lipoprotein receptor-related protein in brain and in cultured neurons of mice deficient in receptor-associated protein and transgenic for apolipoprotein E4 or amyloid precursor protein." Umans L., Serneels L., Lorent K., Dewachter I., Tesseur I., Moechars D., Van Leuven F. Neuroscience 94:315-321 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHA sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1204505 3x 1.0 µg

LDHA sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ESYT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV681529 1.0 µg DNA

ESYT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
hsa-miR-6738-5p miRNA Antagomir
MBS8318082-01 10 nmol

hsa-miR-6738-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6738-5p miRNA Antagomir
MBS8318082-02 20 nmol

hsa-miR-6738-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6738-5p miRNA Antagomir
MBS8318082-03 5x 20 nmol

hsa-miR-6738-5p miRNA Antagomir

Sign In for Pricing
View Details
BMP1 Protein Vector (Human) (pPB-C-His)
PV064721 500 ng

BMP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details