PDGF-AA, Human (His)
PDGF-AA Protein, Human (His) is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.
Product Specifications
Product Name Alternative
PDGF-AA Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-aa-protein-human-his.html
Purity
95.10
Smiles
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Molecular Formula
5154 (Gene_ID) P04085-1 (S87-T211) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Zhao F, et, al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2019 Apr;51 (3) :e13200.|[2]Wu LW, et, al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2019 Feb;33 (2) :2388-2395.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![IHO1 Mouse Monoclonal Antibody [Clone ID: OTI5E11]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9085e5/imageurl/cf808463.webp)
PKSV030400 100 µg
Recombinant SARS-CoV-2 Spike S1 (ΔHV69-70, N439K, D614G) (His Tag)
Sign In for Pricing
View Details 