Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDC, Human (HEK293, His)

NUDC protein is essential for neurogenesis and neuronal migration, contributing to the correct formation of mitotic spindles and chromosome separation during mitosis. It plays a crucial role in cytokinesis and cell proliferation. NUDC interacts with PAFAH1B1, forms a complex with PLK1, dynein, and dynactin, and interacts with DCDC1 and EML4, emphasizing its multifaceted involvement in various cellular processes. NUDC Protein, Human (HEK293, His) is the recombinant human-derived NUDC protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NUDC Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudc-protein-human-hek293-his.html

Purity

98.0

Smiles

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Molecular Formula

10726 (Gene_ID) Q9Y266 (M1-N331) (Accession)

Molecular Weight

Approximately 43-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3A Monoclonal Antibody
RD85557A-01 20 µL

MAP1LC3A Monoclonal Antibody

Sign In for Pricing
View Details
MAP1LC3A Monoclonal Antibody
RD85557A-02 60 μL

MAP1LC3A Monoclonal Antibody

Sign In for Pricing
View Details
MAP1LC3A Monoclonal Antibody
RD85557A-03 120 μL

MAP1LC3A Monoclonal Antibody

Sign In for Pricing
View Details
MAP1LC3A Monoclonal Antibody
RD85557A-04 200 µL

MAP1LC3A Monoclonal Antibody

Sign In for Pricing
View Details
SYTL5 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-4145R-BF750 100 µL

SYTL5 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ZNF778 (NM_001201407) Human Tagged ORF Clone
RG239498 10 µg

ZNF778 (NM_001201407) Human Tagged ORF Clone

Sign In for Pricing
View Details