Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDC, Human (HEK293, His)

NUDC protein is essential for neurogenesis and neuronal migration, contributing to the correct formation of mitotic spindles and chromosome separation during mitosis. It plays a crucial role in cytokinesis and cell proliferation. NUDC interacts with PAFAH1B1, forms a complex with PLK1, dynein, and dynactin, and interacts with DCDC1 and EML4, emphasizing its multifaceted involvement in various cellular processes. NUDC Protein, Human (HEK293, His) is the recombinant human-derived NUDC protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NUDC Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudc-protein-human-hek293-his.html

Purity

98.0

Smiles

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Molecular Formula

10726 (Gene_ID) Q9Y266 (M1-N331) (Accession)

Molecular Weight

Approximately 43-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human XPV Affinity Purified Polyclonal Ab
AF3417 100 µg

Human XPV Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
PHKG2 (NM_001172432) Human Tagged Lenti ORF Clone
RC229959L4 10 µg

PHKG2 (NM_001172432) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
D4DR Polyclonal Antibody
RA24067-01 50 µL

D4DR Polyclonal Antibody

Sign In for Pricing
View Details
D4DR Polyclonal Antibody
RA24067-02 100 µL

D4DR Polyclonal Antibody

Sign In for Pricing
View Details
pCR-BluntII-TOPO-KIAA0087 Plasmid
PVT31058 2 µg

pCR-BluntII-TOPO-KIAA0087 Plasmid

Sign In for Pricing
View Details
KI67 Monoclonal Antibody
E-AB-22027-01 20 µL

KI67 Monoclonal Antibody

Sign In for Pricing
View Details