Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDC, Human (HEK293, His)

NUDC protein is essential for neurogenesis and neuronal migration, contributing to the correct formation of mitotic spindles and chromosome separation during mitosis. It plays a crucial role in cytokinesis and cell proliferation. NUDC interacts with PAFAH1B1, forms a complex with PLK1, dynein, and dynactin, and interacts with DCDC1 and EML4, emphasizing its multifaceted involvement in various cellular processes. NUDC Protein, Human (HEK293, His) is the recombinant human-derived NUDC protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NUDC Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudc-protein-human-hek293-his.html

Purity

98.0

Smiles

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Molecular Formula

10726 (Gene_ID) Q9Y266 (M1-N331) (Accession)

Molecular Weight

Approximately 43-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit
MBS9904657-01 48 Well

Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit

Sign In for Pricing
View Details
Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit
MBS9904657-02 96 Well

Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit

Sign In for Pricing
View Details
Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit
MBS9904657-03 5x 96 Well

Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit

Sign In for Pricing
View Details
Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit
MBS9904657-04 10x 96 Well

Bovine Neuronal Protein 3.1 (C5ORF13) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal JAM-B/VE-JAM Antibody (988905) [Allophycocyanin/Cy7]
FAB10744APCCY7 0.1 mL

Mouse Monoclonal JAM-B/VE-JAM Antibody (988905) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Rabbit Monoclonal COX5b Antibody (031) [DyLight 755]
NBP2-90314IR 0.1 mL

Rabbit Monoclonal COX5b Antibody (031) [DyLight 755]

Sign In for Pricing
View Details