Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPVI, Human (HEK293, His)

GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Human (HEK293, His) is the recombinant human-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPVI Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpvi-protein-human-hek293-his.html

Purity

95.00

Smiles

QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK

Molecular Formula

51206 (Gene_ID) Q9HCN6-1 (Q21-K267) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C-Peptide ELISA Kit
orb438804-01 48 Tests

Rat C-Peptide ELISA Kit

Sign In for Pricing
View Details
Rat C-Peptide ELISA Kit
orb438804-02 96 Tests

Rat C-Peptide ELISA Kit

Sign In for Pricing
View Details
Olfr1229 (NM_001011761) Mouse Tagged Lenti ORF Clone
MR214706L3 10 µg

Olfr1229 (NM_001011761) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RGD1561812 3'UTR GFP Stable Cell Line
TU268457 1.0 mL

RGD1561812 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DYNLRB2 cDNA
551936 10 µg

DYNLRB2 cDNA

Sign In for Pricing
View Details
FECH Human shRNA Plasmid Kit (Locus ID 2235)
TR313007 1 Kit

FECH Human shRNA Plasmid Kit (Locus ID 2235)

Sign In for Pricing
View Details