Noggin, Human (HEK293)

Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.

Product Specifications

Product Name Alternative

Noggin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-human-hek293.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

9241 (Gene_ID) Q13253 (Q28-C232) (Accession)

Molecular Weight

Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23 (12) :4126-4134.|[2]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[3]Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42 (4) :425-33.|[4]Chen C, et al. Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro. J Cell Biochem. 2012 Dec;113 (12) :3672-80.|[5]Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.