Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RuvC, E.coli (His-SUMO)

RuvC protein is an important component of the RuvA-RuvB-RuvC complex and is essential for the processing of Holliday junctions in gene recombination and DNA repair. As an endonuclease, RuvC resolves Holliday junctions by generating symmetric single-stranded nicks that rely on a central homology core. RuvC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RuvC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ruvc-protein-e-coli-his-sumo.html

Purity

90.0

Smiles

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Molecular Formula

946378 (Gene_ID) P0A814 (A2-R173) (Accession)

Molecular Weight

Approximately 34.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4R1 3'UTR Luciferase Stable Cell Line
TU018700 1.0 mL

PPP4R1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TUFM, NT (Elongation Factor Tu, Mitochondrial, EF-Tu, P43) (APC)
MBS6473586-01 0.2 mL

TUFM, NT (Elongation Factor Tu, Mitochondrial, EF-Tu, P43) (APC)

Sign In for Pricing
View Details
TUFM, NT (Elongation Factor Tu, Mitochondrial, EF-Tu, P43) (APC)
MBS6473586-02 5x 0.2 mL

TUFM, NT (Elongation Factor Tu, Mitochondrial, EF-Tu, P43) (APC)

Sign In for Pricing
View Details
APIP Rabbit Polyclonal Antibody
orb1175159 100 µg

APIP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DRP2 AAV Vector (Rat) (CMV)
18605106 1 µg

DRP2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Human PAPPA (Pappalysin-1) ELISA Kit
EKF58771 96 Tests

Human PAPPA (Pappalysin-1) ELISA Kit

Sign In for Pricing
View Details