Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENR, Human (His-SUMO)

DENR proteins play a key role in the translation process, participating in mRNA scanning and start codon recognition. It crucially promotes the recruitment of aminoacylated initiator tRNA to the 40S ribosomal P site during translation initiation. DENR Protein, Human (His-SUMO) is the recombinant human-derived DENR protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DENR Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/denr-protein-human-his-sumo.html

Purity

90.0

Smiles

AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Molecular Formula

8562 (Gene_ID) O43583 (A2-K198) (Accession)

Molecular Weight

Approximately 46 kDa.The reducing (R) protein migrat es as 46 kDa in SDS-PAGE may be due to relative charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPP2R2C (NM_001206994) Human Tagged ORF Clone
RG232728 10 µg

PPP2R2C (NM_001206994) Human Tagged ORF Clone

Ask
View Details
PCLAF Polyclonal Antibody
ANT-13675-50ug 50 µg

PCLAF Polyclonal Antibody

Ask
View Details
SNX19 (Sorting Nexin-19, CHET8, KIAA0254) (HRP)
133662-HRP 100 µL

SNX19 (Sorting Nexin-19, CHET8, KIAA0254) (HRP)

Ask
View Details
Glypican 3 (GPC3) (NM_001164618) Human Untagged Clone
SC327094 10 µg

Glypican 3 (GPC3) (NM_001164618) Human Untagged Clone

Ask
View Details
ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (MaxLight 750)
MBS6237255-01 0.1 mL

ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (MaxLight 750)

Ask
View Details
ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (MaxLight 750)
MBS6237255-02 5x 0.1 mL

ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (MaxLight 750)

Ask
View Details