Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENR, Human (His-SUMO)

DENR proteins play a key role in the translation process, participating in mRNA scanning and start codon recognition. It crucially promotes the recruitment of aminoacylated initiator tRNA to the 40S ribosomal P site during translation initiation. DENR Protein, Human (His-SUMO) is the recombinant human-derived DENR protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DENR Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/denr-protein-human-his-sumo.html

Purity

90.0

Smiles

AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Molecular Formula

8562 (Gene_ID) O43583 (A2-K198) (Accession)

Molecular Weight

Approximately 46 kDa.The reducing (R) protein migrat es as 46 kDa in SDS-PAGE may be due to relative charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2132359-01 0.1 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Ask
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2132359-02 0.2 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Ask
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2132359-03 0.5 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Ask
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2132359-04 1 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Ask
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2132359-05 5 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Ask
View Details
HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2132359-06 5x 5 mL

HRP Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Ask
View Details