Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENR, Human (His-SUMO)

DENR proteins play a key role in the translation process, participating in mRNA scanning and start codon recognition. It crucially promotes the recruitment of aminoacylated initiator tRNA to the 40S ribosomal P site during translation initiation. DENR Protein, Human (His-SUMO) is the recombinant human-derived DENR protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DENR Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/denr-protein-human-his-sumo.html

Purity

90.0

Smiles

AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Molecular Formula

8562 (Gene_ID) O43583 (A2-K198) (Accession)

Molecular Weight

Approximately 46 kDa.The reducing (R) protein migrat es as 46 kDa in SDS-PAGE may be due to relative charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KLHL9 Rabbit Polyclonal Antibody
TA377857 100 µL

KLHL9 Rabbit Polyclonal Antibody

Ask
View Details
Lentiviral human PHF10 shRNA (UAS) - Lentiviral human PHF10 shRNA (UAS, iRFP) (100)
GTR15338694 1 Vial

Lentiviral human PHF10 shRNA (UAS) - Lentiviral human PHF10 shRNA (UAS, iRFP) (100)

Ask
View Details
Daphnin (Standard)
HY-N7252R 1 Each

Daphnin (Standard)

Ask
View Details
EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)
MBS6377491-01 0.1 mL

EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)

Ask
View Details
EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)
MBS6377491-02 5x 0.1 mL

EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (PE)

Ask
View Details
Formoterol Impurity 122
RM-F132122-01 10 mg

Formoterol Impurity 122

Ask
View Details