Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFAP3, Human (HEK293, Fc)

MFAP3 (microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cell structure. As a component of elastin-related microfibrils, it is essential in providing structural integrity and elasticity to various tissues in the body. MFAP3 Protein, Human (HEK293, Fc) is the recombinant human-derived MFAP3 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

MFAP3 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfap3-protein-human-hek293-fc.html

Purity

98.0

Smiles

AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDM

Molecular Formula

4238 (Gene_ID) P55082-1 (A19-M147) (Accession)

Molecular Weight

Approximately 55-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEND5 Polyclonal Antibody, PE Conjugated
bs-9270R-PE 100 µL

BEND5 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
MCEE, CT (MCEE, Methylmalonyl-CoA epimerase, mitochondrial, DL-methylmalonyl-CoA racemase) (Biotin) discontinued
038268-Biotin 200 µL

MCEE, CT (MCEE, Methylmalonyl-CoA epimerase, mitochondrial, DL-methylmalonyl-CoA racemase) (Biotin) discontinued

Sign In for Pricing
View Details
3-Fluoro-4-[ (pyridin-3-yl) methoxy]aniline hydrochloride
GHC96787-01 100 mg

3-Fluoro-4-[ (pyridin-3-yl) methoxy]aniline hydrochloride

Sign In for Pricing
View Details
3-Fluoro-4-[ (pyridin-3-yl) methoxy]aniline hydrochloride
GHC96787-02 1 g

3-Fluoro-4-[ (pyridin-3-yl) methoxy]aniline hydrochloride

Sign In for Pricing
View Details
PAK1+PAK2+PAK3 (phospho-Ser144) Antibody Blocking Peptide
orb1510926 500 µg

PAK1+PAK2+PAK3 (phospho-Ser144) Antibody Blocking Peptide

Sign In for Pricing
View Details
TTC38 Rabbit Polyclonal Antibody
TA370643 100 µL

TTC38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details