Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOX-1/OLR1, Human (HEK293, His)

The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) . As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LOX-1/OLR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/olr1-protein-human-hek-293-his.html

Purity

99.00

Smiles

SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Molecular Formula

4973 (Gene_ID) P78380-1 (S61-Q273) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SDF2L1 Protein, N-His
orb2967298-01 50 µg

Recombinant Human SDF2L1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SDF2L1 Protein, N-His
orb2967298-02 100 µg

Recombinant Human SDF2L1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SDF2L1 Protein, N-His
orb2967298-03 1 mg

Recombinant Human SDF2L1 Protein, N-His

Sign In for Pricing
View Details
Phospho-PPP1R14A (Thr38) Antibody Blocking Peptide
orb1504537 500 µg

Phospho-PPP1R14A (Thr38) Antibody Blocking Peptide

Sign In for Pricing
View Details
DHX38 Peptide - N-terminal region
orb2000495 100 µg

DHX38 Peptide - N-terminal region

Sign In for Pricing
View Details
KISS1R 3'UTR Luciferase Stable Cell Line
TU011815 1.0 mL

KISS1R 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details