Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCIP-1 , Mouse (P.pastoris, His, solution)

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

KCIP-1 Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kcip-1-protein-mouse-p-pastoris-his-solution.html

Purity

95.0

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

54401 (Gene_ID) Q9CQV8-1 (M1-N246) (Accession)

Molecular Weight

Approximately 33 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Exportin 5 (XPO5) activation kit by CRISPRa
GA111548 1 Kit

Human Exportin 5 (XPO5) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS704591 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
HOPX / HOD Recombinant Rabbit monoclonal Antibody
HA751349 100 µL

HOPX / HOD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), 0.2mg/mL
BNUB0639-500 1x 500 µL

CD31 / PECAM-1 (JC/70A), 0.2mg/mL

Sign In for Pricing
View Details
PRPF3 Human Gene Knockout Kit (CRISPR)
KN401365 1 Kit

PRPF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TEX101 (NM_001130011) Human Over-expression Lysate
LY427101 100 µg

TEX101 (NM_001130011) Human Over-expression Lysate

Sign In for Pricing
View Details