Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCIP-1 , Mouse (P.pastoris, His, solution)

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

KCIP-1 Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kcip-1-protein-mouse-p-pastoris-his-solution.html

Purity

95.0

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

54401 (Gene_ID) Q9CQV8-1 (M1-N246) (Accession)

Molecular Weight

Approximately 33 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-(-)-3-Phenyllactic Acid
TRC-P335553-500MG 500 mg

L-(-)-3-Phenyllactic Acid

Sign In for Pricing
View Details
14-3-3 beta (YWHAB) (NM_139323) Human Over-expression Lysate
LC403387 20 µg

14-3-3 beta (YWHAB) (NM_139323) Human Over-expression Lysate

Sign In for Pricing
View Details
TentaGel® HL SH
HL12904.0.5G 5 g

TentaGel® HL SH

Sign In for Pricing
View Details
ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI3D11]
CF808235 100 µg

ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI3D11]

Sign In for Pricing
View Details
IKK alpha (CHUK) Human Gene Knockout Kit (CRISPR)
KN416718 1 Kit

IKK alpha (CHUK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFI16 (NM_005531) Human Over-expression Lysate
LY401699 100 µg

IFI16 (NM_005531) Human Over-expression Lysate

Sign In for Pricing
View Details