Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCIP-1 , Mouse (P.pastoris, His, solution)

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

KCIP-1 Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kcip-1-protein-mouse-p-pastoris-his-solution.html

Purity

95.0

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

54401 (Gene_ID) Q9CQV8-1 (M1-N246) (Accession)

Molecular Weight

Approximately 33 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUC7L Lentiviral Activation Particles (m2)
sc-426303-LAC-2 200 µL

LUC7L Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Scarf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6116407 1.0 µg DNA

Scarf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
AGMO Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
11524066 1.0 µg DNA

AGMO Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Rap1a shRNA (UAS) - Lentiviral mouse Rap1a shRNA (UAS, GFP) (100)
GTR15176025 1 Vial

Lentiviral mouse Rap1a shRNA (UAS) - Lentiviral mouse Rap1a shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
beta-Amyloid Peptide (Biotin)
MBS6258247-01 0.1 mL

beta-Amyloid Peptide (Biotin)

Sign In for Pricing
View Details
beta-Amyloid Peptide (Biotin)
MBS6258247-02 5x 0.1 mL

beta-Amyloid Peptide (Biotin)

Sign In for Pricing
View Details