Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4B2, Rat (HEK293, His)

CLEC4B2 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4B2 protein, expressed by HEK293, with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC4B2 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4b2-protein-rat-hek293-his.html

Purity

95.00

Smiles

MMEKPNRRLSELHTYNSNFTCCSDGTMVSGKVWSCCPKDWKPFGSHCYFTTDFVANWNESKEKCSHMGAHLLVIHSQEEQDFINGILDTRWGYFTGLSDQGQNQWQWIDQTPYNESVTFWHEDEPNNDYEKCVEINHHKDIGWGWNDVVCSSEHKSICQVKKIYL

Molecular Formula

450222 (Gene_ID) Q67DU9 (M44-L208) (Accession)

Molecular Weight

Approximately 26-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
BNC940012-500 1x 500 µL

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Pan (MHC II) (HLA-Pan/2967R), CF594 conjugate, 0.1mg/mL
BNC942967-500 1x 500 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details