Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PE-Linked Polyclonal Antibody to 7-Dehydrocholesterol (7-DHC)

Product Specifications

Gene Name

[7-DHC]

Reactivity

General

Storage Conditions

Store at 4 degree C for frequent use. Aliquot and store at -20 degree C for 12 months.<br>Avoid repeated freeze/thaw cycles.<br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Specificity

The antibody is a rabbit polyclonal antibody raised against 7-DHC. It has been selected for its ability to recognize 7-DHC in immunohistochemical staining and western blotting.

Short Name

[7-Dehydrocholesterol (7-DHC)]

CAS Number

9007-83-4

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nr1h2 Mouse shRNA Plasmid (Locus ID 22260)
TL502382 1 Kit

Nr1h2 Mouse shRNA Plasmid (Locus ID 22260)

Ask
View Details
FGF12 Antibody
A16707-100UG 100 µg

FGF12 Antibody

Ask
View Details
Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)
MBS7033322-01 0.02 mg

Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)

Ask
View Details
Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)
MBS7033322-02 0.1 mg

Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)

Ask
View Details
Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)
MBS7033322-03 5x 0.1 mg

Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)

Ask
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Ask
View Details