Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)
Product Specifications
Background
Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.
CAS Number
9000-83-3
Product Name Alternative
Regulator of cell morphogenesis and NO signaling
Gene ID
948724
UniProt
P69506
Target
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Purification
Greater than 85% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 g, ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 g, ml.
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Calculated Molecular Weight
51.9 kD
Formulation
Tris-based buffer, 50% glycerol
Host or Source
E.coli
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942076-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742810-500 1x 500 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details