Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-8 (LGALS8) (Active)

Product Specifications

Background

Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.

CAS Number

9000-83-3

Product Name Alternative

Po66 carbohydrate-binding protein

Gene ID

3964

UniProt

O00214

Target

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Purification

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 g, ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 g, ml.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Calculated Molecular Weight

62.8 kDa

Formulation

Tris-based buffer, 50% glycerol

Host or Source

E.coli

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Protocadherin Beta 3 (PCDHb3)
TRV-0048971-01 10 µg

Recombinant Protocadherin Beta 3 (PCDHb3)

Sign In for Pricing
View Details
Recombinant Protocadherin Beta 3 (PCDHb3)
TRV-0048971-02 50 µg

Recombinant Protocadherin Beta 3 (PCDHb3)

Sign In for Pricing
View Details
Recombinant Protocadherin Beta 3 (PCDHb3)
TRV-0048971-03 100 µg

Recombinant Protocadherin Beta 3 (PCDHb3)

Sign In for Pricing
View Details
Recombinant Protocadherin Beta 3 (PCDHb3)
TRV-0048971-04 200 µg

Recombinant Protocadherin Beta 3 (PCDHb3)

Sign In for Pricing
View Details
Recombinant Protocadherin Beta 3 (PCDHb3)
TRV-0048971-05 500 µg

Recombinant Protocadherin Beta 3 (PCDHb3)

Sign In for Pricing
View Details
Recombinant Protocadherin Beta 3 (PCDHb3)
TRV-0048971-06 1 mg

Recombinant Protocadherin Beta 3 (PCDHb3)

Sign In for Pricing
View Details