Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)

Product Specifications

CAS Number

9000-83-3

Product Name Alternative

ASAH2-like protein; Putative inactive N-acylsphingosine amidohydrolase 2BPutative inactive non-lysosomal ceramidase B

Gene ID

653308

UniProt

P0C7U1

Target

MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Purification

Greater than 90% as determined by SDS-PAGE.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Calculated Molecular Weight

21 kDa

Formulation

Tris-based buffer50% glycerol

Host or Source

Yeast

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AHSG Protein, His Tag
E40KMH536 20 µg

Recombinant Human AHSG Protein, His Tag

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit
RD-MYH4-Mu-48Tests 48 Tests

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit

Sign In for Pricing
View Details
MRPL11P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV770756 1.0 µg DNA

MRPL11P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Polyclonal Anti-CASP7(p11? Antibody
GWB-BBP319 0.1 mg

Polyclonal Anti-CASP7(p11? Antibody

Sign In for Pricing
View Details
KLHL15 Protein Vector (Mouse) (pPB-N-His)
PV194639 500 ng

KLHL15 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Travoprost Epoxide derivative - 3
CS-O-46854 1 Each

Travoprost Epoxide derivative - 3

Sign In for Pricing
View Details