Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)

Product Specifications

CAS Number

9000-83-3

Product Name Alternative

ASAH2-like protein; Putative inactive N-acylsphingosine amidohydrolase 2BPutative inactive non-lysosomal ceramidase B

Gene ID

653308

UniProt

P0C7U1

Target

MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Purification

Greater than 90% as determined by SDS-PAGE.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Calculated Molecular Weight

21 kDa

Formulation

Tris-based buffer50% glycerol

Host or Source

Yeast

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aristolochic Acid B
sc-358881 5 mg

Aristolochic Acid B

Sign In for Pricing
View Details
LOC499124 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
27243066 1.0 µg DNA

LOC499124 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RASSF10 Protein Vector (Mouse) (pPM-C-HA)
PV222628 500 ng

RASSF10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
EnzyChrom™ Pyruvate Kinase Assay Kit
EPRK-100 100 Tests

EnzyChrom™ Pyruvate Kinase Assay Kit

Sign In for Pricing
View Details
TLK1 Polyclonal Antibody
MBS9134823-01 0.02 mL

TLK1 Polyclonal Antibody

Sign In for Pricing
View Details
TLK1 Polyclonal Antibody
MBS9134823-02 0.1 mL

TLK1 Polyclonal Antibody

Sign In for Pricing
View Details