Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgrmc2 3'UTR GFP Stable Cell Line
TU266149 1.0 mL

Pgrmc2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse HMGB1 / High Mobility Group Box 1, Animal Free & Carrier Free
C-CYP229-20ug 20 µg

Recombinant Mouse HMGB1 / High Mobility Group Box 1, Animal Free & Carrier Free

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody (YA3856, Mouse)
HY-P84159-01 10 µL

Wilms Tumor Protein Antibody (YA3856, Mouse)

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody (YA3856, Mouse)
HY-P84159-02 50 μL

Wilms Tumor Protein Antibody (YA3856, Mouse)

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody (YA3856, Mouse)
HY-P84159-03 100 µL

Wilms Tumor Protein Antibody (YA3856, Mouse)

Sign In for Pricing
View Details
THEG5 (NM_001278577) Human Tagged ORF Clone
RC235986 10 µg

THEG5 (NM_001278577) Human Tagged ORF Clone

Sign In for Pricing
View Details