Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Glutamate dehydrogenase (GLDH) ELISA Kit
YP-W80123-01 48 Tests

Porcine Glutamate dehydrogenase (GLDH) ELISA Kit

Sign In for Pricing
View Details
Porcine Glutamate dehydrogenase (GLDH) ELISA Kit
YP-W80123-02 96 Tests

Porcine Glutamate dehydrogenase (GLDH) ELISA Kit

Sign In for Pricing
View Details
Mouse Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit
RDR-TGFbR2-Mu-96Tests 96 Tests

Mouse Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit

Sign In for Pricing
View Details
TRNAY11 Protein Lysate (Human) with C-Ha Tag
48476031 100 µg

TRNAY11 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
KPNA2 Antibody
MBS9408743-01 0.05 mL

KPNA2 Antibody

Sign In for Pricing
View Details
KPNA2 Antibody
MBS9408743-02 0.1 mL

KPNA2 Antibody

Sign In for Pricing
View Details