Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL20 Adenovirus (Rat)
20299056 1.0 mL

FBXL20 Adenovirus (Rat)

Sign In for Pricing
View Details
Human FK506 binding protein 6, 36kDa (FKBP6) ELISA Kit
EIA07782h 1 Kit

Human FK506 binding protein 6, 36kDa (FKBP6) ELISA Kit

Sign In for Pricing
View Details
APC-Linked Anti-Programmed Cell Death Protein 1 Ligand 1 (PDL1) Polyclonal Antibody
MBS2126824-01 0.2 mL

APC-Linked Anti-Programmed Cell Death Protein 1 Ligand 1 (PDL1) Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Anti-Programmed Cell Death Protein 1 Ligand 1 (PDL1) Polyclonal Antibody
MBS2126824-02 5x 0.2 mL

APC-Linked Anti-Programmed Cell Death Protein 1 Ligand 1 (PDL1) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ZNHIT1 Antibody
NBP1-79374 100 µL

Rabbit Polyclonal ZNHIT1 Antibody

Sign In for Pricing
View Details
Asic5 Rat shRNA Plasmid (Locus ID 63866)
TR710605 1 Kit

Asic5 Rat shRNA Plasmid (Locus ID 63866)

Sign In for Pricing
View Details