Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPATA31D3 shRNA (UAS) - Lentiviral human SPATA31D3 shRNA (UAS, GFP) (100)
GTR15127689 1 Vial

Lentiviral human SPATA31D3 shRNA (UAS) - Lentiviral human SPATA31D3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
S100a14 (NM_025393) Mouse Tagged ORF Clone Lentiviral Particle
MR221786L4V 200 µL

S100a14 (NM_025393) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TXNRD2 ORF Vector (Human) (pORF)
48885012 1.0 µg DNA

TXNRD2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Hexim1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3741506 1.0 µg DNA

Hexim1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Hcst (NM_011827) Mouse Tagged Lenti ORF Clone
MR226262L3 10 µg

Hcst (NM_011827) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica mscL Protein (aa 1-136) (strain 8081)
VAng-Wyb1642-inquire Inquire

Recombinant Yersinia Enterocolitica mscL Protein (aa 1-136) (strain 8081)

Sign In for Pricing
View Details