Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pVITRO2-blasti-GFP/SEAP
pvitro2-bgfpsp 20 µg

pVITRO2-blasti-GFP/SEAP

Sign In for Pricing
View Details
Rabbit Polyclonal GPR153 Antibody
NBP3-04100-100ul 100 µL

Rabbit Polyclonal GPR153 Antibody

Sign In for Pricing
View Details
SULT1A2, CT (SULT1A2, STP2, Sulfotransferase 1A2, Aryl sulfotransferase 2, Phenol sulfotransferase 2, Phenol-sulfating phenol sulfotransferase 2) (MaxLight 405)
MBS6352483-01 0.1 mL

SULT1A2, CT (SULT1A2, STP2, Sulfotransferase 1A2, Aryl sulfotransferase 2, Phenol sulfotransferase 2, Phenol-sulfating phenol sulfotransferase 2) (MaxLight 405)

Sign In for Pricing
View Details
SULT1A2, CT (SULT1A2, STP2, Sulfotransferase 1A2, Aryl sulfotransferase 2, Phenol sulfotransferase 2, Phenol-sulfating phenol sulfotransferase 2) (MaxLight 405)
MBS6352483-02 5x 0.1 mL

SULT1A2, CT (SULT1A2, STP2, Sulfotransferase 1A2, Aryl sulfotransferase 2, Phenol sulfotransferase 2, Phenol-sulfating phenol sulfotransferase 2) (MaxLight 405)

Sign In for Pricing
View Details
Bovine 3,5,3'-Triiodothyronine (TT3) ELISA Kit
MBS9914460-01 48 Well

Bovine 3,5,3'-Triiodothyronine (TT3) ELISA Kit

Sign In for Pricing
View Details
Bovine 3,5,3'-Triiodothyronine (TT3) ELISA Kit
MBS9914460-02 96 Well

Bovine 3,5,3'-Triiodothyronine (TT3) ELISA Kit

Sign In for Pricing
View Details