Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1 Recombinant Protein (Rat)
RP201716 100 µg

FOXO1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
DLEC1, ID (DLEC1, DLC1, Deleted in lung and esophageal cancer protein 1, Deleted in lung cancer protein 1) (MaxLight 405) discontinued
034660-ML405 100 µL

DLEC1, ID (DLEC1, DLC1, Deleted in lung and esophageal cancer protein 1, Deleted in lung cancer protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-Human NMNAT3 Polyclonal Antibody
HA496014-01 50 µg

Anti-Human NMNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human NMNAT3 Polyclonal Antibody
HA496014-02 100 µg

Anti-Human NMNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
Mercuric Chloride AR/ACS
1131140 100 100 g

Mercuric Chloride AR/ACS

Sign In for Pricing
View Details
Vmn1r61 Protein Vector (Mouse) (pPM-C-HA)
PV245824 500 ng

Vmn1r61 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details