Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Parathyroid Hormone (PTH) ELISA Kit
RDR-PTH-Ra-96Tests 96 Tests

Rat Parathyroid Hormone (PTH) ELISA Kit

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody [Clone ID: OTI15C5]
TA804749S 30 µL

MDM2 Mouse Monoclonal Antibody [Clone ID: OTI15C5]

Sign In for Pricing
View Details
L-type Ca++ CP α1C (h) -PR
sc-42688-PR 10 µM - 20 µL

L-type Ca++ CP α1C (h) -PR

Sign In for Pricing
View Details
SOX21 Mouse Monoclonal Antibody [Clone ID: LBI7D5]
AMM18011V 100 µL

SOX21 Mouse Monoclonal Antibody [Clone ID: LBI7D5]

Sign In for Pricing
View Details
Scoop 50ml Polypropylene
SCO1008 5 / PCK

Scoop 50ml Polypropylene

Sign In for Pricing
View Details
ZCCHC9 Protein Lysate
OCOA07574-20UG 20 µg

ZCCHC9 Protein Lysate

Sign In for Pricing
View Details