Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-297a-5* AAV miRNA Vector
Amm3042000 500 ng

Inhibitor mmu-miR-297a-5* AAV miRNA Vector

Sign In for Pricing
View Details
Human Netrin G1 (NTNG1) (NM_001113226) AAV Particle
RC225925A1V 250 µL

Human Netrin G1 (NTNG1) (NM_001113226) AAV Particle

Sign In for Pricing
View Details
SHISA6 AAV Vector (Rat) (CMV)
43719106 1 µg

SHISA6 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Clostridum difficile toxin B antibody
MBS530676-01 1 mg

Clostridum difficile toxin B antibody

Sign In for Pricing
View Details
Clostridum difficile toxin B antibody
MBS530676-02 5x 1 mg

Clostridum difficile toxin B antibody

Sign In for Pricing
View Details
OxLDL (Oxidized Lowdensity Lipoprotein) Mouse ELISA Kit
F6279 96 Tests

OxLDL (Oxidized Lowdensity Lipoprotein) Mouse ELISA Kit

Sign In for Pricing
View Details