Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNA4, CT (KCNA4, KCNA4L, Potassium voltage-gated channel subfamily A member 4, HPCN2, Voltage-gated K (+) channel HuKII, Voltage-gated potassium channel HBK4, Voltage-gated potassium channel HK1, Voltage-gated potassium channel subunit Kv1.4) (MaxLight 405) discontinued
037295-ML405 100 µL

KCNA4, CT (KCNA4, KCNA4L, Potassium voltage-gated channel subfamily A member 4, HPCN2, Voltage-gated K (+) channel HuKII, Voltage-gated potassium channel HBK4, Voltage-gated potassium channel HK1, Voltage-gated potassium channel subunit Kv1.4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Ficolin-2 Antibody (16) [HRP]
NBP2-21613H 0.1 mL

Mouse Monoclonal Ficolin-2 Antibody (16) [HRP]

Sign In for Pricing
View Details
PTPLA CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38140154 3x 1.0 µg DNA

PTPLA CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral human RALB shRNA (UAS) - Lentiviral human RALB shRNA (UAS) (100)
GTR15160314 1 Vial

Lentiviral human RALB shRNA (UAS) - Lentiviral human RALB shRNA (UAS) (100)

Sign In for Pricing
View Details
Vmn2r22 (NM_001104637) Mouse Tagged ORF Clone
MR213108 10 µg

Vmn2r22 (NM_001104637) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Receptor activity-modifying protein 2
MBS7043245-01 0.02 mg

Receptor activity-modifying protein 2

Sign In for Pricing
View Details