Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PKC alpha Antibody (MC5) [DyLight 405]
NB600-201V 0.1 mL

Mouse Monoclonal PKC alpha Antibody (MC5) [DyLight 405]

Sign In for Pricing
View Details
ANKS1A Knockout huh-7 Polyclonal Cells
ARG27901 1 Million

ANKS1A Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
Goat Anti-Rat IgG (H&L) Antibody (Polyclonal IgG) - Alkaline Phosphatase
20330029-1 1 mg

Goat Anti-Rat IgG (H&L) Antibody (Polyclonal IgG) - Alkaline Phosphatase

Sign In for Pricing
View Details
Ginsenoside Rk1 10mg
A15674-10 10 mg

Ginsenoside Rk1 10mg

Sign In for Pricing
View Details
A-Apo-oxytetracycline 5mg
A12847-5 5 mg

A-Apo-oxytetracycline 5mg

Sign In for Pricing
View Details
Zfp772 Rat shRNA Plasmid (Locus ID 308320)
TL706028 1 Kit

Zfp772 Rat shRNA Plasmid (Locus ID 308320)

Sign In for Pricing
View Details