Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS3, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIR2DS3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2ds3-protein-human-p-pastoris-his.html

Purity

95.00

Smiles

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Formula

3808 (Gene_ID) Q14952 (H22-H245) (Accession)

Molecular Weight

Approximately 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL
BNC401274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF647 conjugate, 0.1mg/mL
BNC470159-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details