Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Mouse (P.pastoris, His)

Product Specifications

UNSPSC Description

The CD3 epsilon protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3E, together with CD3D, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3 epsilon Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD3 epsilon protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD3 epsilon Protein, Mouse (P.pastoris, His) is 86 a.a., with molecular weight of ~11.9 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-mouse-p-pastoris-his.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Molecular Weight

Approximately 11.9 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Casein kinase I isoform epsilon (CSNK1E) Elisa Kit
EK712018 96 Well

Human Casein kinase I isoform epsilon (CSNK1E) Elisa Kit

Sign In for Pricing
View Details
Mouse Monoclonal TYRP1 Antibody (TYRP1/3281) [DyLight 594]
NBP3-08897DL594 100 µL

Mouse Monoclonal TYRP1 Antibody (TYRP1/3281) [DyLight 594]

Sign In for Pricing
View Details
Thsd4 (NM_172444) Mouse Tagged Lenti ORF Clone
MR221919L4 10 µg

Thsd4 (NM_172444) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AKR1A1 (NM_001202413) Human Tagged ORF Clone
RC232482 10 µg

AKR1A1 (NM_001202413) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG)
MBS1251332-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG)
MBS1251332-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG)

Sign In for Pricing
View Details