CD3 epsilon, Mouse (P.pastoris, His)
Product Specifications
UNSPSC Description
The CD3 epsilon protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3E, together with CD3D, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3 epsilon Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD3 epsilon protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD3 epsilon Protein, Mouse (P.pastoris, His) is 86 a.a., with molecular weight of ~11.9 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-mouse-p-pastoris-his.html
Purity
95.0
Smiles
DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Molecular Weight
Approximately 11.9 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog