Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Mouse (P.pastoris, His)

Product Specifications

UNSPSC Description

The CD3 epsilon protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3E, together with CD3D, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3 epsilon Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD3 epsilon protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD3 epsilon Protein, Mouse (P.pastoris, His) is 86 a.a., with molecular weight of ~11.9 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-mouse-p-pastoris-his.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Molecular Weight

Approximately 11.9 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued
354336-01 48 Tests

BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued
354336-02 96 Tests

BTN2A1 (Butyrophilin subfamily 2 member A1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
CCDC42 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8131R-APC-Cy5.5 100 µL

CCDC42 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human NFYC qPCR Primer Pair
QH19033S 200 Tests

Human NFYC qPCR Primer Pair

Sign In for Pricing
View Details
SIK2 Polyclonal Antibody
UB-GEN-6604 100 µL

SIK2 Polyclonal Antibody

Sign In for Pricing
View Details
UQCRB Polyclonal Conjugated Antibody
MBS9439660-01 0.1 mL (Biotin)

UQCRB Polyclonal Conjugated Antibody

Sign In for Pricing
View Details