Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils

Human Amyloid Beta Pyroglutamate 3-42 PFFs

Product Specifications

Background

Our Amyloid Beta pyroglutamate 3-42 (pyro Aβ) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2) . Our pyro Aβ3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody. Amyloid beta peptide (Aβ) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of Aβ plaques in the brain is considered a hallmark of Alzheimer’s disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3) . Pyroglutamate Aβ 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to comprise 15-45% of total amyloid beta deposits in brains of AD patients (4,5) . Pyroglutamate Aβ 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length Aβ 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8) .

Product Name Alternative

Pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AβPE3, APP

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

351

Swiss Prot

P05067

Cellular Locus

Cell Membrane | Intracellular Vesicles

Expression System

Synthetic

Origin Species

Human

Target

Amyloid Beta Pyroglutamate 3-42

Conjugation

No Tag

Nature

Synthetic (TFA preparation, HFIP treated precursor)

Sequence

pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Applications

WB | In vivo Assay | In vitro Assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Amyloid

Limit Of Detection

Protein certified >95% pure by mass spec and HPLC. Low endotoxin <2.5 EU/mL @ 1mg/mL.

Concentration

1 mg/ml

Purity

>95%

Weight

0.01

Length

40 amino acids

Buffer

10mM HCl with 2% DMSO

Molecular Weight

4.3 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information.

References & Citations

1. Stine et al. 2003. JBC. 278(13):11612-22; doi: 10.1074/jbc.M210207200 2. Chromy et al. 2003. Biochemistry. 42:12749-12760; doi: 10.1021/bi030029q 3. Panza et al. 2019. Nat Rev Neurol. 15:73-88; https://doi.org/10.1038/s41582-018-0116-6 4. Valverde et al. 2021. JBC. 297:100963; https://doi.org/10.1016/j.jbc.2021.100963 5. Schilling et al. 2008. Nat Med. 14:1106-11; DOI: 10.1038/nm.1872 6. Hartlage-Rubsamen et al. 2011. Acta Neuropathol. 121:705-19; 10.1007/s00401-011-0806-2 7. Xu, Wang and Wu. 2021. J Med Chem. 64:6549–65; DOI: 10.1021/acs.jmedchem.1c00325 8. Bayer. 2021. Nat Mol Psych. 27:1880-1885; https://doi.org/10.1038/s41380-021-01409-3

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information.

Protein Length

40 amino acids

Background Reference 01

1. Stine et al. 2003. JBC. 278 (13) :11612-22; doi: 10.1074/jbc.M210207200 2. Chromy et al. 2003. Biochemistry. 42:12749-12760; doi: 10.1021/bi030029q 3. Panza et al. 2019. Nat Rev Neurol. 15:73-88; https://doi.org/10.1038/s41582-018-0116-6 4. Valverde et al. 2021. JBC. 297:100963; https://doi.org/10.1016/j.jbc.2021.100963 5. Schilling et al. 2008. Nat Med. 14:1106-11; DOI: 10.1038/nm.1872 6. Hartlage-Rubsamen et al. 2011. Acta Neuropathol. 121:705-19; 10.1007/s00401-011-0806-2 7. Xu, Wang and Wu. 2021. J Med Chem. 64:6549–65; DOI: 10.1021/acs.jmedchem.1c00325 8. Bayer. 2021. Nat Mol Psych. 27:1880-1885; https://doi.org/10.1038/s41380-021-01409-3

Location

Cell Membrane | Intracellular Vesicles

AA Sequence

PyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Immunogen Species

Human

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-01 48 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Ask
View Details
Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-02 96 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Ask
View Details
Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-03 5x 96 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Ask
View Details
Human Ras-related protein Rab-11A, RAB11A ELISA Kit
MBS9339459-04 10x 96 Well

Human Ras-related protein Rab-11A, RAB11A ELISA Kit

Ask
View Details
AdmiRa-Off-mmu-miR-7031-5p Virus
mm6607 1.0 mL

AdmiRa-Off-mmu-miR-7031-5p Virus

Ask
View Details
Mouse Monoclonal ACBD7 Antibody (08) [DyLight 755]
NBP3-06599IR 0.1 mL

Mouse Monoclonal ACBD7 Antibody (08) [DyLight 755]

Ask
View Details