Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha Synuclein Pre-formed Fibrils

Rat Recombinant Alpha Synuclein PFFs

Product Specifications

Background

Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1) . Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2) . Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4) . SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6) . The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.

Product Name Alternative

Alpha synuclein pre-formed fibrils, Alpha Synuclein PFFs, Alpha Synuclein PFF, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

29219

Swiss Prot

P37377

Accession Number

NP_062042.1

Cellular Locus

Cytoplasm | Membrane | Nucleus

Expression System

E. coli

Host

E. coli

Origin Species

Rat

Target

Alpha Synuclein

Conjugation

No Tag

Nature

Recombinant

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

Applications

WB | SDS-PAGE | In vivo assay | In vitro assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy

Purification Method

Ion-exchange Purified

Purification

Ion-exchange Purified

Limit Of Detection

Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

Concentration

2 mg/ml

Purity

>95%

Weight

0.05

Length

Full Length

Buffer

PBS pH 7.4

Molecular Weight

14.515 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-481.

References & Citations

1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-481.

Protein Length

Full Length

Background Reference 01

1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013) . 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277 (3) : 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231 (1) : 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388 (6645) : 839-840. 6. Mezey E., et al. (1998) Nat Med. 4 (7) : 755-757. 7. Polymeropoulos, M. H. (1998) . Science. 276 (5321), 2045–2047 8. Conway, K.E., et al. (1998) . Nat Med. 4 (11) :1318-20

Location

Cytoplasm | Membrane | Nucleus

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

Immunogen Species

Rat

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VARS2 (NM_001167733) Human Untagged Clone
SC329223 10 µg

VARS2 (NM_001167733) Human Untagged Clone

Sign In for Pricing
View Details
FIG4 Polyclonal Antibody
RA24966-01 50 µL

FIG4 Polyclonal Antibody

Sign In for Pricing
View Details
FIG4 Polyclonal Antibody
RA24966-02 100 µL

FIG4 Polyclonal Antibody

Sign In for Pricing
View Details
Aflatoxin B2
orb3054590-01 25 mg

Aflatoxin B2

Sign In for Pricing
View Details
Aflatoxin B2
orb3054590-02 50 mg

Aflatoxin B2

Sign In for Pricing
View Details
Aflatoxin B2
orb3054590-03 100 mg

Aflatoxin B2

Sign In for Pricing
View Details