Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha Synuclein Monomers

Rat Recombinant Alpha Synuclein Monomers

Product Specifications

Background

Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1) . Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2) . Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4) . SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6) . The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.

Product Name Alternative

Alpha synuclein pre-formed fibrils, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

29219

Swiss Prot

P37377

Accession Number

NP_062042.1

Cellular Locus

Cytoplasm | Membrane | Nucleus

Expression System

E. coli

Host

E. coli

Origin Species

Rat

Target

Alpha Synuclein

Conjugation

No Tag

Nature

Recombinant

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

Applications

WB | SDS-PAGE | In vivo assay | In vitro assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy

Purification Method

Ion-exchange Purified

Purification

Ion-exchange Purified

Limit Of Detection

Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

Concentration

2 mg/ml

Purity

>95%

Weight

0.05

Length

Full Length

Buffer

PBS pH 7.4

Molecular Weight

14.515 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For corresponding PFFs, see catalog# SPR-482

References & Citations

1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

For corresponding PFFs, see catalog# SPR-482

Protein Length

Full Length

Background Reference 01

1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013) . 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277 (3) : 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231 (1) : 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388 (6645) : 839-840. 6. Mezey E., et al. (1998) Nat Med. 4 (7) : 755-757. 7. Polymeropoulos, M. H. (1998) . Science. 276 (5321), 2045–2047 8. Conway, K.E., et al. (1998) . Nat Med. 4 (11) :1318-20

Location

Cytoplasm | Membrane | Nucleus

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

Immunogen Species

Rat

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCHL1 (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L1, UCH-L1, Neuron Cytoplasmic Protein 9.5, PGP 9.5, PGP9.5, Ubiquitin Thioesterase L1)
135047 100 µg

UCHL1 (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L1, UCH-L1, Neuron Cytoplasmic Protein 9.5, PGP 9.5, PGP9.5, Ubiquitin Thioesterase L1)

Sign In for Pricing
View Details
Native Human Epidermal growth factor receptor-2, HER2 Protein
BNP1036 100 μg

Native Human Epidermal growth factor receptor-2, HER2 Protein

Sign In for Pricing
View Details
1110051M20Rik siRNA Oligos set (Mouse)
10059174 3x 5 nmol

1110051M20Rik siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
NEP-IN-2
HY-U00336 1 Each

NEP-IN-2

Sign In for Pricing
View Details
Human anti parotid duct antibody ELISA kit
GTR10461322 96 Well

Human anti parotid duct antibody ELISA kit

Sign In for Pricing
View Details
Pdxdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
36344114 3x 1.0 µg

Pdxdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details